PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART09G10360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bHLH
Protein Properties Length: 269aa    MW: 27294.5 Da    PI: 6.1696
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART09G10360.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH36.86.9e-12190238555
                      HHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
              HLH   5 hnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                      h+++Er RR+ri +++  L+el+P+a  ++    +Ka++L + ++Y+k Lq
  OBART09G10360.1 190 HSIAERLRRERIAERMKALQELVPNA--NKLMQTDKASMLDEIIDYVKFLQ 238
                      99***********************7..48888*****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474597.33E-16183245IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.05E-11183241No hitNo description
PROSITE profilePS5088816.787185237IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.103.5E-15189245IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000103.0E-9190238IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003532.3E-12191243IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MAAAAAAGQI SLADLRNGGG VAANAAGGGG VHDDFLDQML SSLPPSAWPD LAAGKAAEDD  60
AEGMHHHHHQ QQQQFGGPYD ESAMLASRLR QHQISGGGGG GGGGAAAVKQ MVLQQLADLR  120
QGHHMMLQGL GDDGADDSDA ELGGGGGGGG GGTASGGGAA QPQAGAAGGG APAPPRQRVR  180
ARRGQATDPH SIAERLRRER IAERMKALQE LVPNANKLMQ TDKASMLDEI IDYVKFLQLQ  240
VLSMSRLGGA AAVAPLVADM SSEVTLVLR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1194199RLRRER
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0057840.0AP005784.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0014G10.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238169.12e-78PREDICTED: transcription factor bHLH66 isoform X2
TrEMBLA0A0D3H6W50.0A0A0D3H6W5_9ORYZ; Uncharacterized protein
STRINGBRADI4G30350.14e-80(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141937118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24260.15e-17LJRHL1-like 1